Project name: LepB_3F_Guide

Status: done

submitted: 2026-06-03 03:13:51, status changed: 2026-06-03 09:49:03

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADFFFEGDD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.7342 7.38591 40.156 227
cluster_2.pdb ( medoid) 15.6172 9.73287 42.7296 152
cluster_3.pdb ( medoid) 13.1545 10.4147 35.9289 137
cluster_4.pdb ( medoid) 10.5883 14.45 59.4369 153
cluster_5.pdb ( medoid) 10.4035 5.3828 26.5414 56
cluster_6.pdb ( medoid) 7.21982 6.92538 33.7431 50
cluster_7.pdb ( medoid) 6.36243 13.8312 53.9232 88
cluster_8.pdb ( medoid) 4.18684 16.4802 42.2053 69
cluster_9.pdb ( medoid) 3.9592 12.1237 31.0365 48
cluster_10.pdb ( medoid) 1.1937 16.7546 31.7275 20