CABS-dock: 42a4a43dba3a5aa

Project name: 42a4a43dba3a5aa

Status: done

submitted: 2026-01-21 23:14:56, status changed: 2026-01-22 01:45:08

Project settings

Protein sequence(s)	RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP input pdb
Peptide sequence	SEALKLKELNDKKELEQRLS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHCCHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.2795	3.03116	13.2699	113
cluster_2.pdb ( medoid)	32.7538	6.04509	18.9861	198
cluster_3.pdb ( medoid)	26.7433	6.84283	20.8864	183
cluster_4.pdb ( medoid)	23.1149	4.41275	11.2137	102
cluster_5.pdb ( medoid)	15.7532	5.96703	14.8732	94
cluster_6.pdb ( medoid)	13.7134	4.88573	17.9152	67
cluster_7.pdb ( medoid)	9.0188	9.42475	18.717	85
cluster_8.pdb ( medoid)	7.58042	7.51938	17.5031	57
cluster_9.pdb ( medoid)	7.54527	6.09654	14.8969	46
cluster_10.pdb ( medoid)	5.15755	10.664	26.2535	55