Project name: JSLEE_19

Status: done

submitted: 2023-11-27 09:46:06, status changed: 2023-11-27 11:39:39

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence ENNVLSPLPSQAMDDLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Contact information
126:A 26:PEP 6.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.2142 6.61739 26.4914 147
cluster_2.pdb ( medoid) 15.6432 10.4199 25.0194 163
cluster_3.pdb ( medoid) 11.8145 6.85597 25.5774 81
cluster_4.pdb ( medoid) 11.7831 7.80782 22.204 92
cluster_5.pdb ( medoid) 10.3175 13.5692 35.4647 140
cluster_6.pdb ( medoid) 9.55669 9.94068 22.7626 95
cluster_7.pdb ( medoid) 7.87906 14.4687 30.99 114
cluster_8.pdb ( medoid) 5.40087 13.8866 26.2847 75
cluster_9.pdb ( medoid) 5.09381 11.779 24.2795 60
cluster_10.pdb ( medoid) 2.41671 13.6549 28.7661 33