Project name: 4324be641ffbc2c

Status: done

submitted: 2026-02-27 05:56:10, status changed: 2026-02-28 06:44:45

Project settings
Protein sequence(s) YDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKEL input pdb
Peptide sequence KKELVREVGFEICFKDHHEKI
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHCCEEECCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.8147 3.91249 23.8098 101
cluster_2.pdb ( medoid) 17.0372 4.7543 29.2359 81
cluster_3.pdb ( medoid) 15.4095 14.7961 33.357 228
cluster_4.pdb ( medoid) 14.2091 9.21942 55.5873 131
cluster_5.pdb ( medoid) 10.9406 4.93576 30.9452 54
cluster_6.pdb ( medoid) 9.95235 11.0527 35.4509 110
cluster_7.pdb ( medoid) 6.60231 7.72457 24.0407 51
cluster_8.pdb ( medoid) 4.53188 19.6387 55.3899 89
cluster_9.pdb ( medoid) 4.26382 7.97408 16.1379 34
cluster_10.pdb ( medoid) 3.30037 6.36292 15.7014 21