CABS-dock: 432517b237cfa88

Project name: 432517b237cfa88

Status: done

submitted: 2026-07-01 10:14:22, status changed: 2026-07-01 13:11:46

Project settings

Protein sequence(s)	LATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK input pdb
Peptide sequence	DGYWLV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	48.8046	3.58573	20.3447	175
cluster_2.pdb ( medoid)	30.2395	5.55564	15.5165	168
cluster_3.pdb ( medoid)	24.1148	6.13731	18.2715	148
cluster_4.pdb ( medoid)	22.9616	4.87772	24.6231	112
cluster_5.pdb ( medoid)	21.9897	5.45711	15.0723	120
cluster_6.pdb ( medoid)	17.2724	5.44221	21.9184	94
cluster_7.pdb ( medoid)	10.1743	7.17493	16.5616	73
cluster_8.pdb ( medoid)	6.62818	7.69442	20.2766	51
cluster_9.pdb ( medoid)	3.86314	11.6486	36.2385	45
cluster_10.pdb ( medoid)	1.03867	13.4788	27.1296	14