Project name: 432517b237cfa88

Status: done

submitted: 2026-07-01 10:14:22, status changed: 2026-07-01 13:11:46

Project settings
Protein sequence(s) LATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK input pdb
Peptide sequence DGYWLV
Simulation mc cycles50
Peptide secondary structure psipred CCCEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.8046 3.58573 20.3447 175
cluster_2.pdb ( medoid) 30.2395 5.55564 15.5165 168
cluster_3.pdb ( medoid) 24.1148 6.13731 18.2715 148
cluster_4.pdb ( medoid) 22.9616 4.87772 24.6231 112
cluster_5.pdb ( medoid) 21.9897 5.45711 15.0723 120
cluster_6.pdb ( medoid) 17.2724 5.44221 21.9184 94
cluster_7.pdb ( medoid) 10.1743 7.17493 16.5616 73
cluster_8.pdb ( medoid) 6.62818 7.69442 20.2766 51
cluster_9.pdb ( medoid) 3.86314 11.6486 36.2385 45
cluster_10.pdb ( medoid) 1.03867 13.4788 27.1296 14