Project name: TPT5hlj@

Status: done

submitted: 2025-07-08 11:58:08, status changed: 2025-07-08 16:09:04

Project settings
Protein sequence(s) DAYPVESEIINLTINGVARGNHFNFVNGTLQTRNYGKVYVAGQGTSDSELVKKKGDIILTSLLGDGDHTLNVNKAESKELELYARVYNNTKRDITVDSVSLSPGLNATGREFSANKFVLYFKPTVLKKNRINTLVFGATFDEDIDDTNRHYLLSMRFSPGNDLFKVGEK input pdb
Peptide sequence TPTYIAPSSLKA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.2124 4.43067 23.9646 125
cluster_2.pdb ( medoid) 25.9231 4.59049 12.7437 119
cluster_3.pdb ( medoid) 25.0599 4.94813 33.3675 124
cluster_4.pdb ( medoid) 14.6549 6.55071 24.5295 96
cluster_5.pdb ( medoid) 10.5151 10.5562 34.031 111
cluster_6.pdb ( medoid) 9.66981 12.8234 27.0144 124
cluster_7.pdb ( medoid) 8.43179 8.77631 25.5111 74
cluster_8.pdb ( medoid) 7.90183 10.2508 24.8693 81
cluster_9.pdb ( medoid) 6.87759 13.5222 33.2192 93
cluster_10.pdb ( medoid) 4.17089 12.7071 32.9429 53