CABS-dock: 1ma2

Project name: 1ma2

Status: done

submitted: 2025-12-12 13:51:56, status changed: 2025-12-12 15:27:51

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	KWCFRVCYRGICYRRCR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEECEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.5857	1.97729	12.2359	102
cluster_2.pdb ( medoid)	25.4743	4.8284	22.9735	123
cluster_3.pdb ( medoid)	24.1381	5.71711	29.4931	138
cluster_4.pdb ( medoid)	13.7254	13.4786	31.4054	185
cluster_5.pdb ( medoid)	9.2083	11.8371	27.0572	109
cluster_6.pdb ( medoid)	7.73143	13.4516	34.8228	104
cluster_7.pdb ( medoid)	7.11727	13.2073	27.9946	94
cluster_8.pdb ( medoid)	4.84359	12.594	31.0355	61
cluster_9.pdb ( medoid)	3.61016	14.9578	30.6092	54
cluster_10.pdb ( medoid)	1.62779	18.4299	32.5102	30