Project name: 7NUI_HRDSVD_E2

Status: done

submitted: 2026-05-30 16:03:35, status changed: 2026-05-31 15:41:18

Project settings
Protein sequence(s) GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence HRDSVDSAPILTAFNSSHKGRI
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCHHHCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 57.0828 1.83943 20.7034 105
cluster_2.pdb ( medoid) 43.7182 4.712 21.2633 206
cluster_3.pdb ( medoid) 30.7511 2.08122 16.0358 64
cluster_4.pdb ( medoid) 21.4283 1.40002 8.3032 30
cluster_5.pdb ( medoid) 16.4479 0.547181 1.29153 9
cluster_6.pdb ( medoid) 15.4185 12.6471 42.8502 195
cluster_7.pdb ( medoid) 12.7164 9.75118 25.9957 124
cluster_8.pdb ( medoid) 5.03906 13.0977 43.0263 66
cluster_9.pdb ( medoid) 3.68169 18.1982 42.8551 67
cluster_10.pdb ( medoid) 3.28562 10.3481 21.3031 34