CABS-dock: 4439d2e65b9e316

Project name: 4439d2e65b9e316

Status: done

submitted: 2026-04-11 11:57:11, status changed: 2026-04-11 14:42:03

Project settings

Protein sequence(s)	QRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGSSTWLSEAEMIALAGLLQMSQGEQTPNCVASSLPSTSCPDPVSVSEDPGPSGDQSCSGTDT input pdb
Peptide sequence	SSTWLSEAEMIALAGLLQMSQGEQTPNCV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHHHHHHHHHHHHCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.4954	3.18883	17.3155	110
cluster_2.pdb ( medoid)	22.4064	4.86468	22.5433	109
cluster_3.pdb ( medoid)	22.1412	6.95535	25.3758	154
cluster_4.pdb ( medoid)	16.2256	6.96432	32.4388	113
cluster_5.pdb ( medoid)	14.267	8.69136	25.9271	124
cluster_6.pdb ( medoid)	8.84043	10.5198	24.6976	93
cluster_7.pdb ( medoid)	7.42612	11.5807	30.5198	86
cluster_8.pdb ( medoid)	5.859	14.1662	29.8676	83
cluster_9.pdb ( medoid)	4.71628	17.1746	37.061	81
cluster_10.pdb ( medoid)	2.81818	16.6774	29.0603	47