Project name: 8TBP_KWTLQD_E2

Status: done

submitted: 2026-05-30 16:16:58, status changed: 2026-05-31 07:27:21

Project settings
Protein sequence(s) DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence KWTLQDVSLEVYLTAP
Simulation mc cycles200
Peptide secondary structure psipred CCCCEEEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.6808 4.13939 13.9257 127
cluster_2.pdb ( medoid) 28.314 3.56715 22.5789 101
cluster_3.pdb ( medoid) 25.9032 5.21172 26.0287 135
cluster_4.pdb ( medoid) 25.7703 8.18771 21.9433 211
cluster_5.pdb ( medoid) 20.9791 4.86198 23.1138 102
cluster_6.pdb ( medoid) 16.4519 7.71946 27.3315 127
cluster_7.pdb ( medoid) 9.33516 5.46321 11.8904 51
cluster_8.pdb ( medoid) 8.75058 9.59936 20.8355 84
cluster_9.pdb ( medoid) 3.12404 11.8436 21.3998 37
cluster_10.pdb ( medoid) 2.35914 10.5971 24.7904 25