CABS-dock: 44b734d21a9771e

Project name: 44b734d21a9771e

Status: done

submitted: 2026-07-16 14:02:10, status changed: 2026-07-16 16:33:36

Project settings

Protein sequence(s)	LTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence	TPIMSMPPLLK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	88.5769	1.15154	17.0516	102
cluster_2.pdb ( medoid)	30.1564	3.51501	14.6116	106
cluster_3.pdb ( medoid)	24.7472	5.37435	13.5988	133
cluster_4.pdb ( medoid)	18.2384	5.53775	16.03	101
cluster_5.pdb ( medoid)	18.1263	4.52382	27.6681	82
cluster_6.pdb ( medoid)	15.4591	7.3096	20.8472	113
cluster_7.pdb ( medoid)	12.0248	12.1415	29.4436	146
cluster_8.pdb ( medoid)	9.19305	7.28812	17.6004	67
cluster_9.pdb ( medoid)	8.25622	10.053	19.2472	83
cluster_10.pdb ( medoid)	7.63512	8.77524	27.9415	67