Project name: 44f2a774ceba233

Status: done

submitted: 2026-04-10 04:21:48, status changed: 2026-04-10 06:29:25

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRRVQLYPGSNDARRRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.6459 8.52735 30.7281 159
cluster_2.pdb ( medoid) 15.4843 8.00809 31.7236 124
cluster_3.pdb ( medoid) 9.3171 11.3769 27.7471 106
cluster_4.pdb ( medoid) 9.11051 10.8666 28.5619 99
cluster_5.pdb ( medoid) 8.65557 13.0552 36.9639 113
cluster_6.pdb ( medoid) 7.48949 12.2839 28.5779 92
cluster_7.pdb ( medoid) 7.33989 13.4879 28.423 99
cluster_8.pdb ( medoid) 5.93475 11.9634 35.6334 71
cluster_9.pdb ( medoid) 5.37633 11.904 27.6691 64
cluster_10.pdb ( medoid) 4.55671 16.0203 33.5248 73