CABS-dock: 44fd935f2fdeb46

Project name: 44fd935f2fdeb46

Status: done

submitted: 2026-03-16 07:31:10, status changed: 2026-03-17 00:39:25

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRRRRAGGVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	14.9654	10.4909	41.8175	157
cluster_2.pdb ( medoid)	12.5307	11.1725	44.6945	140
cluster_3.pdb ( medoid)	11.2884	8.85867	23.0426	100
cluster_4.pdb ( medoid)	9.62675	12.673	45.7767	122
cluster_5.pdb ( medoid)	8.57389	10.6136	27.5679	91
cluster_6.pdb ( medoid)	8.06497	12.5233	37.2593	101
cluster_7.pdb ( medoid)	5.57556	18.2941	39.5369	102
cluster_8.pdb ( medoid)	4.98645	19.0516	47.7656	95
cluster_9.pdb ( medoid)	3.5244	13.6194	38.0214	48
cluster_10.pdb ( medoid)	2.51035	17.5275	44.7243	44