Project name: Trail_223_to_236_

Status: done

submitted: 2025-12-26 17:36:10, status changed: 2025-12-26 21:54:20

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence MKSARNSCWSKDAE
Simulation mc cycles100
Peptide secondary structure psipred CCCCCHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 107.772 0.965003 17.0628 104
cluster_2.pdb ( medoid) 21.7659 6.01858 18.1429 131
cluster_3.pdb ( medoid) 15.3796 9.75316 37.2607 150
cluster_4.pdb ( medoid) 14.2949 10.3533 28.1702 148
cluster_5.pdb ( medoid) 9.75 13.9487 44.6905 136
cluster_6.pdb ( medoid) 9.6318 8.202 20.8049 79
cluster_7.pdb ( medoid) 9.39298 2.44864 10.7452 23
cluster_8.pdb ( medoid) 9.13258 12.5923 26.3656 115
cluster_9.pdb ( medoid) 9.12063 8.4424 24.5313 77
cluster_10.pdb ( medoid) 3.1883 11.6049 34.2236 37