Project name: 4592ecfd24a5241

Status: done

submitted: 2026-03-16 22:34:45, status changed: 2026-03-17 02:20:51

Project settings
Protein sequence(s) MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPMTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP input pdb
Peptide sequence WGWSLSHGYQVK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.717 3.25489 16.318 113
cluster_2.pdb ( medoid) 34.3692 2.47315 5.54509 85
cluster_3.pdb ( medoid) 30.4066 1.97326 4.443 60
cluster_4.pdb ( medoid) 25.2391 4.23945 18.5795 107
cluster_5.pdb ( medoid) 17.4505 8.02271 22.4352 140
cluster_6.pdb ( medoid) 15.4007 8.24638 19.4377 127
cluster_7.pdb ( medoid) 13.5061 8.58874 22.7385 116
cluster_8.pdb ( medoid) 10.9346 10.0598 23.7894 110
cluster_9.pdb ( medoid) 10.2258 5.67191 13.2263 58
cluster_10.pdb ( medoid) 7.04401 11.925 29.7983 84