CABS-dock: LVIPVSPAEPVP

Project name: LVIPVSPAEPVP

Status: done

submitted: 2026-04-02 10:05:31, status changed: 2026-04-02 10:35:04

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	LVIPVSPAEPVP
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.1546	2.67333	17.6302	102
cluster_2.pdb ( medoid)	22.8493	4.5078	27.322	103
cluster_3.pdb ( medoid)	11.7124	13.4046	33.514	157
cluster_4.pdb ( medoid)	10.8821	7.07585	19.085	77
cluster_5.pdb ( medoid)	9.27962	14.117	45.624	131
cluster_6.pdb ( medoid)	9.01301	15.4222	47.5379	139
cluster_7.pdb ( medoid)	6.6295	10.7097	25.6808	71
cluster_8.pdb ( medoid)	6.33062	12.1631	27.6681	77
cluster_9.pdb ( medoid)	4.85844	13.3788	32.9453	65
cluster_10.pdb ( medoid)	2.20284	14.0727	27.9029	31