CABS-dock: p85-CD133

Project name: p85-CD133

Status: done

submitted: 2025-12-16 00:00:19, status changed: 2025-12-16 10:39:02

Project settings

Protein sequence(s)	GSEDLPHHDEKTWNVGGSSSSNNRRNNKKAAEENNLLRGKRDGTFLVRREEESSSSKKQQGGCCYACSVVVDDGEEVKHCVVINKKTATGYGFAEPYNLYSSLKKELVLHYQHTSLVQHNDSSLNVVTLAYPVYA input pdb
Peptide sequence	MENGNNGYHKDHVYGIHNPVMTSPSQH
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	46.2421	2.91942	13.2027	135
cluster_2.pdb ( medoid)	24.2356	5.32275	16.4494	129
cluster_3.pdb ( medoid)	13.7409	9.82467	23.7319	135
cluster_4.pdb ( medoid)	9.86662	13.7838	28.2468	136
cluster_5.pdb ( medoid)	8.85041	9.94304	31.702	88
cluster_6.pdb ( medoid)	7.49436	13.2099	29.3026	99
cluster_7.pdb ( medoid)	5.99241	17.689	31.6458	106
cluster_8.pdb ( medoid)	4.91244	13.4353	30.0561	66
cluster_9.pdb ( medoid)	4.80114	15.6213	28.9527	75
cluster_10.pdb ( medoid)	2.11202	14.6779	30.3658	31