Project name: YWHAG_ABI3_D203_1433

Status: done

submitted: 2025-04-13 00:22:49, status changed: 2025-04-13 14:25:54

Project settings
Protein sequence(s) MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN input pdb
Peptide sequence VPDGRLDAASS
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 101.161 0.672197 3.69321 68
cluster_2.pdb ( medoid) 53.1416 3.42481 12.1482 182
cluster_3.pdb ( medoid) 40.928 5.10653 12.514 209
cluster_4.pdb ( medoid) 30.4895 6.16605 28.9556 188
cluster_5.pdb ( medoid) 21.3 5.39906 19.6209 115
cluster_6.pdb ( medoid) 17.1054 4.67688 25.2832 80
cluster_7.pdb ( medoid) 10.4868 5.7215 25.8008 60
cluster_8.pdb ( medoid) 9.67809 4.13305 8.99373 40
cluster_9.pdb ( medoid) 2.69424 12.2484 28.6214 33
cluster_10.pdb ( medoid) 2.05843 12.1452 23.3812 25