CABS-dock: YWHAG_ABI3_D203

Project name: YWHAG_ABI3_D203_1433

Status: done

submitted: 2025-04-13 00:22:49, status changed: 2025-04-13 14:25:54

Project settings

Protein sequence(s)	MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN input pdb
Peptide sequence	VPDGRLDAASS
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	101.161	0.672197	3.69321	68
cluster_2.pdb ( medoid)	53.1416	3.42481	12.1482	182
cluster_3.pdb ( medoid)	40.928	5.10653	12.514	209
cluster_4.pdb ( medoid)	30.4895	6.16605	28.9556	188
cluster_5.pdb ( medoid)	21.3	5.39906	19.6209	115
cluster_6.pdb ( medoid)	17.1054	4.67688	25.2832	80
cluster_7.pdb ( medoid)	10.4868	5.7215	25.8008	60
cluster_8.pdb ( medoid)	9.67809	4.13305	8.99373	40
cluster_9.pdb ( medoid)	2.69424	12.2484	28.6214	33
cluster_10.pdb ( medoid)	2.05843	12.1452	23.3812	25