CABS-dock: 1o8y

Project name: 1o8y

Status: done

submitted: 2025-12-12 14:16:08, status changed: 2025-12-12 15:47:22

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	GRCTKSIPPICFPD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.522	6.56553	30.2846	161
cluster_2.pdb ( medoid)	20.6064	5.48372	27.548	113
cluster_3.pdb ( medoid)	12.7524	8.31218	25.2853	106
cluster_4.pdb ( medoid)	10.2832	11.3777	26.9262	117
cluster_5.pdb ( medoid)	9.14424	8.74868	23.1856	80
cluster_6.pdb ( medoid)	9.06265	11.4757	24.9042	104
cluster_7.pdb ( medoid)	7.41662	15.5057	39.146	115
cluster_8.pdb ( medoid)	6.15356	16.0883	38.4482	99
cluster_9.pdb ( medoid)	5.07367	14.5851	30.4027	74
cluster_10.pdb ( medoid)	2.31785	13.3744	30.5876	31