Project name: 48ddaeb1b9afb44

Status: done

submitted: 2026-03-18 10:04:23, status changed: 2026-03-18 12:09:54

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRRRVQLFGSNTYRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.8457 7.36987 27.6265 161
cluster_2.pdb ( medoid) 18.6294 6.92455 45.4415 129
cluster_3.pdb ( medoid) 14.1556 6.9937 22.6445 99
cluster_4.pdb ( medoid) 11.2774 11.7048 30.8942 132
cluster_5.pdb ( medoid) 7.19132 13.4885 28.1116 97
cluster_6.pdb ( medoid) 6.59982 13.4852 34.3594 89
cluster_7.pdb ( medoid) 5.84295 14.8897 33.3279 87
cluster_8.pdb ( medoid) 5.19499 13.8595 38.6184 72
cluster_9.pdb ( medoid) 4.9126 14.4526 30.9407 71
cluster_10.pdb ( medoid) 3.07986 20.4555 40.8821 63