CABS-dock: 48ddaeb1b9afb44

Project name: 48ddaeb1b9afb44

Status: done

submitted: 2026-03-18 10:04:23, status changed: 2026-03-18 12:09:54

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRRVQLFGSNTYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.8457	7.36987	27.6265	161
cluster_2.pdb ( medoid)	18.6294	6.92455	45.4415	129
cluster_3.pdb ( medoid)	14.1556	6.9937	22.6445	99
cluster_4.pdb ( medoid)	11.2774	11.7048	30.8942	132
cluster_5.pdb ( medoid)	7.19132	13.4885	28.1116	97
cluster_6.pdb ( medoid)	6.59982	13.4852	34.3594	89
cluster_7.pdb ( medoid)	5.84295	14.8897	33.3279	87
cluster_8.pdb ( medoid)	5.19499	13.8595	38.6184	72
cluster_9.pdb ( medoid)	4.9126	14.4526	30.9407	71
cluster_10.pdb ( medoid)	3.07986	20.4555	40.8821	63