Project name: D4DN23_UPPS

Status: done

submitted: 2026-06-13 05:53:46, status changed: 2026-06-13 10:58:28

Project settings
Protein sequence(s) KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence PGCLLPP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.4029 8.46625 35.4353 232
cluster_2.pdb ( medoid) 24.7145 5.70516 25.8802 141
cluster_3.pdb ( medoid) 14.4516 4.1518 12.8209 60
cluster_4.pdb ( medoid) 11.54 8.3189 29.1631 96
cluster_5.pdb ( medoid) 10.5018 9.33171 26.8165 98
cluster_6.pdb ( medoid) 9.51173 9.35686 27.4299 89
cluster_7.pdb ( medoid) 9.34259 7.81368 28.135 73
cluster_8.pdb ( medoid) 6.97943 10.7459 31.6886 75
cluster_9.pdb ( medoid) 6.24722 13.7661 30.6379 86
cluster_10.pdb ( medoid) 3.29116 15.1922 36.5105 50