CABS-dock: 49c49ad937ed73c

Project name: 49c49ad937ed73c

Status: done

submitted: 2026-01-21 16:20:41, status changed: 2026-01-21 20:26:29

Project settings

Protein sequence(s)	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVI input pdb
Peptide sequence	FISYDGNNKYYADSVKG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.0534	5.86195	19.7733	141
cluster_2.pdb ( medoid)	19.0014	6.05217	16.8831	115
cluster_3.pdb ( medoid)	12.7645	8.3826	28.5847	107
cluster_4.pdb ( medoid)	12.6356	6.96444	19.4302	88
cluster_5.pdb ( medoid)	11.1776	8.67807	24.2704	97
cluster_6.pdb ( medoid)	9.77072	7.26661	21.3304	71
cluster_7.pdb ( medoid)	9.73785	9.55036	23.704	93
cluster_8.pdb ( medoid)	8.62426	11.0154	31.23	95
cluster_9.pdb ( medoid)	8.25887	11.6239	32.0255	96
cluster_10.pdb ( medoid)	7.85312	12.3518	31.5581	97