CABS-dock: 4a4096babe7ae4f

Project name: 4a4096babe7ae4f

Status: done

submitted: 2026-07-08 09:36:03, status changed: 2026-07-08 13:22:34

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	DFQNHEAGHFTLGDS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.3983	3.02411	15.9057	101
cluster_2.pdb ( medoid)	32.0775	3.58507	24.6371	115
cluster_3.pdb ( medoid)	21.3012	7.18268	36.894	153
cluster_4.pdb ( medoid)	20.1352	9.98253	30.5201	201
cluster_5.pdb ( medoid)	13.6685	8.194	22.9564	112
cluster_6.pdb ( medoid)	7.93606	11.9707	30.952	95
cluster_7.pdb ( medoid)	4.16375	21.6151	49.4194	90
cluster_8.pdb ( medoid)	4.00834	12.973	28.7528	52
cluster_9.pdb ( medoid)	3.85996	12.4353	35.3157	48
cluster_10.pdb ( medoid)	2.09851	15.7255	37.9346	33