Project name: 4a4096babe7ae4f

Status: done

submitted: 2026-07-08 09:36:03, status changed: 2026-07-08 13:22:34

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence DFQNHEAGHFTLGDS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.3983 3.02411 15.9057 101
cluster_2.pdb ( medoid) 32.0775 3.58507 24.6371 115
cluster_3.pdb ( medoid) 21.3012 7.18268 36.894 153
cluster_4.pdb ( medoid) 20.1352 9.98253 30.5201 201
cluster_5.pdb ( medoid) 13.6685 8.194 22.9564 112
cluster_6.pdb ( medoid) 7.93606 11.9707 30.952 95
cluster_7.pdb ( medoid) 4.16375 21.6151 49.4194 90
cluster_8.pdb ( medoid) 4.00834 12.973 28.7528 52
cluster_9.pdb ( medoid) 3.85996 12.4353 35.3157 48
cluster_10.pdb ( medoid) 2.09851 15.7255 37.9346 33