Project name: JSLEE_20

Status: done

submitted: 2023-11-27 15:15:39, status changed: 2023-11-27 18:17:19

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence ENNVLSPLPSQAMDDLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Contact information
146:A 5:PEP 15.0 1.0
126:A 12:PEP 6.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.4728 3.76889 10.8143 145
cluster_2.pdb ( medoid) 24.6203 6.25501 22.0238 154
cluster_3.pdb ( medoid) 14.3507 7.80452 25.0942 112
cluster_4.pdb ( medoid) 11.5518 7.61783 27.6363 88
cluster_5.pdb ( medoid) 10.9737 9.5683 31.1197 105
cluster_6.pdb ( medoid) 9.50193 9.15603 30.7597 87
cluster_7.pdb ( medoid) 9.18251 7.51428 22.7266 69
cluster_8.pdb ( medoid) 8.46851 9.68293 30.3616 82
cluster_9.pdb ( medoid) 7.43879 9.14127 17.9953 68
cluster_10.pdb ( medoid) 6.29984 14.2861 31.0685 90