CABS-dock: 4b34a399dbcdb78

Project name: 4b34a399dbcdb78

Status: done

submitted: 2026-01-22 13:19:31, status changed: 2026-01-22 20:21:36

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	MATPSPTTTSVPEDEKVEES
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.3236	4.43329	23.3564	130
cluster_2.pdb ( medoid)	21.7765	6.42896	29.608	140
cluster_3.pdb ( medoid)	20.0783	4.38285	11.8584	88
cluster_4.pdb ( medoid)	20.051	7.28142	17.8	146
cluster_5.pdb ( medoid)	9.74666	6.56635	32.4392	64
cluster_6.pdb ( medoid)	8.83228	10.1899	28.1721	90
cluster_7.pdb ( medoid)	8.3689	13.7414	30.2858	115
cluster_8.pdb ( medoid)	6.13403	16.3025	41.0497	100
cluster_9.pdb ( medoid)	4.67962	7.47924	30.1585	35
cluster_10.pdb ( medoid)	4.01938	22.8891	43.1775	92