CABS-dock: 251229 IgV_Only

Project name: 251229 IgV_Only_4

Status: done

submitted: 2025-12-29 08:38:35, status changed: 2025-12-29 11:47:21

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	WHRSYYTWNLNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	36.1813	3.37191	32.8458	122
cluster_2.pdb ( medoid)	24.4933	7.34896	31.137	180
cluster_3.pdb ( medoid)	20.1093	6.16631	35.4212	124
cluster_4.pdb ( medoid)	15.4612	8.14942	18.5315	126
cluster_5.pdb ( medoid)	14.3586	5.43229	13.3048	78
cluster_6.pdb ( medoid)	12.6795	5.44187	22.408	69
cluster_7.pdb ( medoid)	12.3251	5.84176	24.9876	72
cluster_8.pdb ( medoid)	9.67744	10.6433	31.565	103
cluster_9.pdb ( medoid)	7.44787	10.07	30.5726	75
cluster_10.pdb ( medoid)	6.23306	8.18218	22.2968	51