Project name: 4c0a9fe02b0adfe

Status: done

submitted: 2026-07-08 09:35:16, status changed: 2026-07-08 13:23:27

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence ARARDFNGSSGGYDE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 51.5386 1.88209 8.8544 97
cluster_2.pdb ( medoid) 26.2786 4.56645 11.4133 120
cluster_3.pdb ( medoid) 20.8149 6.82205 27.5997 142
cluster_4.pdb ( medoid) 16.0264 7.05089 31.9192 113
cluster_5.pdb ( medoid) 11.5166 11.6354 32.3928 134
cluster_6.pdb ( medoid) 9.4319 10.6023 21.4016 100
cluster_7.pdb ( medoid) 9.06233 10.7037 36.2742 97
cluster_8.pdb ( medoid) 9.0021 6.33185 15.7199 57
cluster_9.pdb ( medoid) 6.14128 13.3523 34.5513 82
cluster_10.pdb ( medoid) 6.05892 9.57267 26.6374 58