Project name: 4c816ff7d088246

Status: done

submitted: 2026-06-23 17:06:35, status changed: 2026-06-24 03:09:46

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence VQLFGYHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.0706 2.79015 24.0012 56
cluster_2.pdb ( medoid) 17.7437 5.91758 20.6761 105
cluster_3.pdb ( medoid) 14.9791 9.01258 36.1838 135
cluster_4.pdb ( medoid) 14.3003 12.0977 57.3242 173
cluster_5.pdb ( medoid) 12.7377 8.94984 30.2811 114
cluster_6.pdb ( medoid) 7.22071 15.9264 50.0453 115
cluster_7.pdb ( medoid) 7.00301 15.4219 61.5261 108
cluster_8.pdb ( medoid) 6.97923 12.0357 40.2624 84
cluster_9.pdb ( medoid) 4.35166 16.7752 43.8309 73
cluster_10.pdb ( medoid) 1.60415 23.0652 44.1405 37