Project name: 4cab43f666ac3e

Status: done

submitted: 2026-03-18 10:03:36, status changed: 2026-03-18 14:31:22

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRRVQLFGSNTYRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.9614 3.73815 22.432 112
cluster_2.pdb ( medoid) 18.109 8.17273 39.9701 148
cluster_3.pdb ( medoid) 16.3796 10.0124 35.2862 164
cluster_4.pdb ( medoid) 7.64733 17.2609 44.5016 132
cluster_5.pdb ( medoid) 6.46619 15.4651 34.2121 100
cluster_6.pdb ( medoid) 6.07568 16.6237 42.7295 101
cluster_7.pdb ( medoid) 5.86062 8.36088 34.6144 49
cluster_8.pdb ( medoid) 5.85842 15.3625 45.3771 90
cluster_9.pdb ( medoid) 3.62982 16.5298 31.196 60
cluster_10.pdb ( medoid) 2.59937 16.9272 42.9341 44