CABS-dock: D3DN1

Project name: D3DN1_UPPS

Status: done

submitted: 2026-06-10 14:03:49, status changed: 2026-06-10 19:04:24

Project settings

Protein sequence(s)	KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence	DPPF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	154.139	0.655254	30.5443	101
cluster_2.pdb ( medoid)	99.4607	1.50813	5.918	150
cluster_3.pdb ( medoid)	43.2804	3.6275	18.3589	157
cluster_4.pdb ( medoid)	12.2519	6.03988	27.0203	74
cluster_5.pdb ( medoid)	9.5938	10.8403	37.8625	104
cluster_6.pdb ( medoid)	8.95864	15.6274	37.5932	140
cluster_7.pdb ( medoid)	7.35895	11.007	31.4526	81
cluster_8.pdb ( medoid)	5.74625	12.5299	35.2455	72
cluster_9.pdb ( medoid)	5.37849	10.2259	24.5247	55
cluster_10.pdb ( medoid)	3.76877	17.5123	41.1972	66