CABS-dock: 4db44c7fa4991a

Project name: 4db44c7fa4991a

Status: done

submitted: 2026-03-09 08:50:38, status changed: 2026-03-09 10:47:29

Project settings

Protein sequence(s)	ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV input pdb
Peptide sequence	PPLSQETFSDLWKLLPEN
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	57.3557	5.68383	30.9285	326
cluster_2.pdb ( medoid)	27.6876	5.05641	14.7359	140
cluster_3.pdb ( medoid)	21.2803	4.51122	11.1707	96
cluster_4.pdb ( medoid)	14.9315	5.75965	16.4163	86
cluster_5.pdb ( medoid)	11.6923	7.7829	32.4738	91
cluster_6.pdb ( medoid)	9.01509	9.98326	25.5622	90
cluster_7.pdb ( medoid)	6.48094	9.87511	26.6821	64
cluster_8.pdb ( medoid)	6.23483	5.29285	20.7012	33
cluster_9.pdb ( medoid)	4.96312	10.0743	26.6289	50
cluster_10.pdb ( medoid)	1.5909	15.0858	29.9827	24