CABS-dock: 4ed274bb5b78f19

Project name: 4ed274bb5b78f19

Status: done

submitted: 2026-03-16 09:25:04, status changed: 2026-03-17 02:32:43

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRGGVQLFGSNTYGGRRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEECCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	17.6779	8.71142	59.1792	154
cluster_2.pdb ( medoid)	13.9818	8.94021	43.895	125
cluster_3.pdb ( medoid)	13.1696	8.80818	48.3869	116
cluster_4.pdb ( medoid)	10.5468	12.8	52.8634	135
cluster_5.pdb ( medoid)	7.64074	9.68493	28.7475	74
cluster_6.pdb ( medoid)	7.37532	11.5249	33.4459	85
cluster_7.pdb ( medoid)	6.83265	14.9283	56.0933	102
cluster_8.pdb ( medoid)	6.52551	10.1142	29.5584	66
cluster_9.pdb ( medoid)	2.91617	26.4045	68.8038	77
cluster_10.pdb ( medoid)	2.73979	24.0894	55.7321	66