Project name: 4f6568def0d58e0

Status: done

submitted: 2026-01-19 17:35:43, status changed: 2026-01-19 20:46:24

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIFVQVGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.0605 5.27836 25.4318 127
cluster_2.pdb ( medoid) 17.0767 10.7163 37.7579 183
cluster_3.pdb ( medoid) 16.8423 8.1343 25.32 137
cluster_4.pdb ( medoid) 15.5089 8.83361 30.5006 137
cluster_5.pdb ( medoid) 11.2323 12.1079 30.8084 136
cluster_6.pdb ( medoid) 7.83542 12.8902 31.4459 101
cluster_7.pdb ( medoid) 5.61873 11.3905 32.1202 64
cluster_8.pdb ( medoid) 4.37655 12.3385 29.3301 54
cluster_9.pdb ( medoid) 1.90014 14.7358 26.6052 28
cluster_10.pdb ( medoid) 1.86914 17.6552 44.3773 33