CABS-dock: 4f6568def0d58e0

Project name: 4f6568def0d58e0

Status: done

submitted: 2026-01-19 17:35:43, status changed: 2026-01-19 20:46:24

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIFVQVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.0605	5.27836	25.4318	127
cluster_2.pdb ( medoid)	17.0767	10.7163	37.7579	183
cluster_3.pdb ( medoid)	16.8423	8.1343	25.32	137
cluster_4.pdb ( medoid)	15.5089	8.83361	30.5006	137
cluster_5.pdb ( medoid)	11.2323	12.1079	30.8084	136
cluster_6.pdb ( medoid)	7.83542	12.8902	31.4459	101
cluster_7.pdb ( medoid)	5.61873	11.3905	32.1202	64
cluster_8.pdb ( medoid)	4.37655	12.3385	29.3301	54
cluster_9.pdb ( medoid)	1.90014	14.7358	26.6052	28
cluster_10.pdb ( medoid)	1.86914	17.6552	44.3773	33