Project name: 5025b5cc29b76a2

Status: done

submitted: 2026-06-17 06:19:20, status changed: 2026-06-17 16:37:53

Project settings
Protein sequence(s) ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGY input pdb
Peptide sequence KEIELPKSYEET
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.1015 5.88194 35.5671 130
cluster_2.pdb ( medoid) 18.9999 11.3159 45.8184 215
cluster_3.pdb ( medoid) 16.5494 7.55315 30.6068 125
cluster_4.pdb ( medoid) 12.489 7.28642 37.3167 91
cluster_5.pdb ( medoid) 11.8208 9.89784 23.8829 117
cluster_6.pdb ( medoid) 6.73492 11.4329 33.1787 77
cluster_7.pdb ( medoid) 5.90755 11.3414 24.3369 67
cluster_8.pdb ( medoid) 5.63662 13.4833 35.9607 76
cluster_9.pdb ( medoid) 5.31548 12.2284 32.2028 65
cluster_10.pdb ( medoid) 4.2188 8.77027 18.9418 37