CABS-dock: 5025b5cc29b76a2

Project name: 5025b5cc29b76a2

Status: done

submitted: 2026-06-17 06:19:20, status changed: 2026-06-17 16:37:53

Project settings

Protein sequence(s)	ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGY input pdb
Peptide sequence	KEIELPKSYEET
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.1015	5.88194	35.5671	130
cluster_2.pdb ( medoid)	18.9999	11.3159	45.8184	215
cluster_3.pdb ( medoid)	16.5494	7.55315	30.6068	125
cluster_4.pdb ( medoid)	12.489	7.28642	37.3167	91
cluster_5.pdb ( medoid)	11.8208	9.89784	23.8829	117
cluster_6.pdb ( medoid)	6.73492	11.4329	33.1787	77
cluster_7.pdb ( medoid)	5.90755	11.3414	24.3369	67
cluster_8.pdb ( medoid)	5.63662	13.4833	35.9607	76
cluster_9.pdb ( medoid)	5.31548	12.2284	32.2028	65
cluster_10.pdb ( medoid)	4.2188	8.77027	18.9418	37