CABS-dock: CREB5_350_430_cJun_1_30

Project name: CREB5_350_430_cJun_1_30_run1

Status: done

submitted: 2026-07-16 06:03:16, status changed: 2026-07-16 08:26:57

Project settings

Protein sequence(s)	MQPTQTIQPPQPTGGRRRKVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ input pdb
Peptide sequence	ETTFYDDALNASFLQSESGAYGYSNPKILK
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCHHHHHHHHCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.9658	4.30174	19.4889	116
cluster_2.pdb ( medoid)	24.0487	5.57202	24.233	134
cluster_3.pdb ( medoid)	17.173	11.0057	22.1816	189
cluster_4.pdb ( medoid)	9.78725	8.78695	22.3817	86
cluster_5.pdb ( medoid)	9.42561	10.3972	25.9291	98
cluster_6.pdb ( medoid)	7.83898	11.4811	28.5492	90
cluster_7.pdb ( medoid)	7.669	14.6043	28.1499	112
cluster_8.pdb ( medoid)	6.33129	9.47674	22.8359	60
cluster_9.pdb ( medoid)	4.34318	11.2821	23.5509	49
cluster_10.pdb ( medoid)	3.45054	19.1274	33.5808	66