CABS-dock: 506ef7d8925216f

Project name: 506ef7d8925216f

Status: done

submitted: 2026-07-16 14:01:55, status changed: 2026-07-17 01:16:46

Project settings

Protein sequence(s)	DKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALDKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIALDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL input pdb
Peptide sequence	TLRNDNSSRFGK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.6447	3.29396	16.5455	124
cluster_2.pdb ( medoid)	37.0547	5.6673	18.7097	210
cluster_3.pdb ( medoid)	30.1101	4.01859	13.1353	121
cluster_4.pdb ( medoid)	24.6933	7.08693	24.2941	175
cluster_5.pdb ( medoid)	18.5861	6.1336	18.1233	114
cluster_6.pdb ( medoid)	10.4959	7.33623	29.6174	77
cluster_7.pdb ( medoid)	5.68629	11.6069	31.7878	66
cluster_8.pdb ( medoid)	5.42389	6.63731	15.2551	36
cluster_9.pdb ( medoid)	4.44703	8.76991	15.861	39
cluster_10.pdb ( medoid)	3.33847	11.3825	22.8593	38