Project name: 5094308f657e296

Status: done

submitted: 2026-03-19 09:41:23, status changed: 2026-03-19 16:37:42

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence KRLVQVFGSNTYRLK
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.5934 6.17555 40.1199 121
cluster_2.pdb ( medoid) 18.6859 6.9571 49.2738 130
cluster_3.pdb ( medoid) 14.4964 10.5544 39.9738 153
cluster_4.pdb ( medoid) 9.65444 13.3617 30.6105 129
cluster_5.pdb ( medoid) 8.60591 11.5037 28.469 99
cluster_6.pdb ( medoid) 5.80614 16.5342 39.6494 96
cluster_7.pdb ( medoid) 5.78827 16.067 36.6672 93
cluster_8.pdb ( medoid) 4.35923 13.5345 32.0454 59
cluster_9.pdb ( medoid) 3.92281 15.5501 34.893 61
cluster_10.pdb ( medoid) 3.57633 16.4974 37.0311 59