CABS-dock: 50f57e96601ab01

Project name: 50f57e96601ab01

Status: done

submitted: 2026-07-29 04:55:43, status changed: 2026-07-29 06:42:20

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGDSNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.4074	3.56208	18.0356	119
cluster_2.pdb ( medoid)	22.2196	10.0362	31.5847	223
cluster_3.pdb ( medoid)	19.7132	6.94964	34.3079	137
cluster_4.pdb ( medoid)	12.5112	6.95376	17.2206	87
cluster_5.pdb ( medoid)	11.8198	9.64481	25.2179	114
cluster_6.pdb ( medoid)	6.00068	13.8318	32.4016	83
cluster_7.pdb ( medoid)	5.29252	11.9036	33.6364	63
cluster_8.pdb ( medoid)	5.27445	12.7027	30.74	67
cluster_9.pdb ( medoid)	5.23134	11.8516	25.0998	62
cluster_10.pdb ( medoid)	4.62668	9.7262	21.2922	45