Project name: 50f57e96601ab01

Status: done

submitted: 2026-07-29 04:55:43, status changed: 2026-07-29 06:42:20

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQLFGDSNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.4074 3.56208 18.0356 119
cluster_2.pdb ( medoid) 22.2196 10.0362 31.5847 223
cluster_3.pdb ( medoid) 19.7132 6.94964 34.3079 137
cluster_4.pdb ( medoid) 12.5112 6.95376 17.2206 87
cluster_5.pdb ( medoid) 11.8198 9.64481 25.2179 114
cluster_6.pdb ( medoid) 6.00068 13.8318 32.4016 83
cluster_7.pdb ( medoid) 5.29252 11.9036 33.6364 63
cluster_8.pdb ( medoid) 5.27445 12.7027 30.74 67
cluster_9.pdb ( medoid) 5.23134 11.8516 25.0998 62
cluster_10.pdb ( medoid) 4.62668 9.7262 21.2922 45