CABS-dock: 5104ba47f1f17cc

Project name: 5104ba47f1f17cc

Status: done

submitted: 2026-03-14 06:13:33, status changed: 2026-03-14 17:37:15

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRWKWKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.7489	4.00016	41.5728	111
cluster_2.pdb ( medoid)	18.1594	7.98483	29.2226	145
cluster_3.pdb ( medoid)	18.1396	6.17433	40.7794	112
cluster_4.pdb ( medoid)	17.8352	6.44791	35.9784	115
cluster_5.pdb ( medoid)	15.3475	8.79621	33.5698	135
cluster_6.pdb ( medoid)	6.2318	14.2816	34.5898	89
cluster_7.pdb ( medoid)	5.52882	14.4696	33.8413	80
cluster_8.pdb ( medoid)	3.69917	17.8418	43.0789	66
cluster_9.pdb ( medoid)	3.2082	14.3382	34.0121	46
cluster_10.pdb ( medoid)	3.15733	24.7044	50.4024	78