Project name: 51e7c6646fea919

Status: done

submitted: 2026-01-21 11:07:58, status changed: 2026-01-21 13:27:31

Project settings
Protein sequence(s) GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence TRSMTSEGLRSSGAMAG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.5938 5.16391 25.215 127
cluster_2.pdb ( medoid) 21.8216 6.41567 18.5805 140
cluster_3.pdb ( medoid) 18.1196 7.34013 22.7222 133
cluster_4.pdb ( medoid) 15.0128 11.1905 30.4696 168
cluster_5.pdb ( medoid) 14.1359 6.01304 16.267 85
cluster_6.pdb ( medoid) 13.698 7.08135 16.2692 97
cluster_7.pdb ( medoid) 6.71234 11.6204 24.1687 78
cluster_8.pdb ( medoid) 5.19107 13.4847 29.3799 70
cluster_9.pdb ( medoid) 4.79103 9.18384 21.0298 44
cluster_10.pdb ( medoid) 4.47338 12.9656 25.6805 58