CABS-dock: 522a6f2d6158ca4

Project name: 522a6f2d6158ca4

Status: done

submitted: 2026-03-12 07:56:44, status changed: 2026-03-12 11:34:36

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRMKWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.4042	6.02685	24.8789	129
cluster_2.pdb ( medoid)	15.9959	11.4404	46.3698	183
cluster_3.pdb ( medoid)	13.4882	12.1588	39.7697	164
cluster_4.pdb ( medoid)	8.97319	10.1413	28.7369	91
cluster_5.pdb ( medoid)	8.25558	10.2961	24.6091	85
cluster_6.pdb ( medoid)	8.18007	10.7579	24.3415	88
cluster_7.pdb ( medoid)	7.0665	14.0098	31.0662	99
cluster_8.pdb ( medoid)	3.87024	16.278	40.0974	63
cluster_9.pdb ( medoid)	3.16185	14.8647	34.653	47
cluster_10.pdb ( medoid)	3.1001	16.4511	36.4539	51