Project name: 52b0a2e4f269588

Status: done

submitted: 2026-03-09 04:41:27, status changed: 2026-03-09 07:12:15

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQLFGSNTA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.3156 7.03253 24.5886 171
cluster_2.pdb ( medoid) 17.2048 7.2073 26.1819 124
cluster_3.pdb ( medoid) 16.9215 8.03711 31.5895 136
cluster_4.pdb ( medoid) 16.6491 8.34882 32.2194 139
cluster_5.pdb ( medoid) 9.3316 7.28707 19.7308 68
cluster_6.pdb ( medoid) 7.24898 11.5878 27.0533 84
cluster_7.pdb ( medoid) 6.60767 10.2911 21.9937 68
cluster_8.pdb ( medoid) 6.4434 11.019 22.9133 71
cluster_9.pdb ( medoid) 6.24055 12.1784 26.5853 76
cluster_10.pdb ( medoid) 5.8843 10.7065 25.4009 63