Project name: 5319cc74db47d97

Status: done

submitted: 2026-01-21 16:22:50, status changed: 2026-01-21 19:47:25

Project settings
Protein sequence(s) AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVI input pdb
Peptide sequence RASQSVGSSYLA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.0796 6.1671 15.8884 130
cluster_2.pdb ( medoid) 19.0434 4.20094 21.8652 80
cluster_3.pdb ( medoid) 18.7821 7.87986 18.9938 148
cluster_4.pdb ( medoid) 16.807 10.2934 35.0469 173
cluster_5.pdb ( medoid) 14.4 7.5 23.0854 108
cluster_6.pdb ( medoid) 9.44327 6.9891 20.8733 66
cluster_7.pdb ( medoid) 7.75625 11.7325 29.6128 91
cluster_8.pdb ( medoid) 7.21947 12.4663 29.7036 90
cluster_9.pdb ( medoid) 7.03392 9.95178 25.5897 70
cluster_10.pdb ( medoid) 3.67366 11.9772 21.4689 44