CABS-dock: 5319cc74db47d97

Project name: 5319cc74db47d97

Status: done

submitted: 2026-01-21 16:22:50, status changed: 2026-01-21 19:47:25

Project settings

Protein sequence(s)	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVI input pdb
Peptide sequence	RASQSVGSSYLA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.0796	6.1671	15.8884	130
cluster_2.pdb ( medoid)	19.0434	4.20094	21.8652	80
cluster_3.pdb ( medoid)	18.7821	7.87986	18.9938	148
cluster_4.pdb ( medoid)	16.807	10.2934	35.0469	173
cluster_5.pdb ( medoid)	14.4	7.5	23.0854	108
cluster_6.pdb ( medoid)	9.44327	6.9891	20.8733	66
cluster_7.pdb ( medoid)	7.75625	11.7325	29.6128	91
cluster_8.pdb ( medoid)	7.21947	12.4663	29.7036	90
cluster_9.pdb ( medoid)	7.03392	9.95178	25.5897	70
cluster_10.pdb ( medoid)	3.67366	11.9772	21.4689	44