CABS-dock: 532bc8d900289ff

Project name: 532bc8d900289ff

Status: done

submitted: 2025-04-22 19:58:45, status changed: 2025-04-23 00:28:21

Project settings

Protein sequence(s)	AWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCWTLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRV input pdb
Peptide sequence	LPNYNWNSFGLRF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	82.7289	1.30547	6.35524	108
cluster_2.pdb ( medoid)	72.7738	1.47031	14.2679	107
cluster_3.pdb ( medoid)	30.238	6.64727	16.5444	201
cluster_4.pdb ( medoid)	29.35	3.50937	12.1739	103
cluster_5.pdb ( medoid)	23.258	5.03053	30.0768	117
cluster_6.pdb ( medoid)	15.1395	8.98312	22.8914	136
cluster_7.pdb ( medoid)	10.8134	6.01109	17.1726	65
cluster_8.pdb ( medoid)	9.58565	7.82419	20.7727	75
cluster_9.pdb ( medoid)	6.55677	6.25308	15.1917	41
cluster_10.pdb ( medoid)	5.85144	8.03221	20.881	47