CABS-dock: 53311dfb97227c7

Project name: 53311dfb97227c7

Status: done

submitted: 2026-04-12 08:12:40, status changed: 2026-04-12 11:08:58

Project settings

Protein sequence(s)	LPLNLCFAAIREDDLLLHQLLKRGLDPNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCCRDAEGSVPLWEAMVEGHEKVVKVLLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIEMVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKALFRE input pdb
Peptide sequence	WHKY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	70.4313	2.54148	9.05851	179
cluster_2.pdb ( medoid)	57.7646	3.15072	21.9303	182
cluster_3.pdb ( medoid)	22.5071	3.99874	9.82086	90
cluster_4.pdb ( medoid)	20.5837	5.58694	20.5406	115
cluster_5.pdb ( medoid)	18.5035	6.26909	27.4758	116
cluster_6.pdb ( medoid)	18.2536	6.46449	31.4665	118
cluster_7.pdb ( medoid)	10.4063	5.47744	25.134	57
cluster_8.pdb ( medoid)	5.69468	11.5898	33.9846	66
cluster_9.pdb ( medoid)	2.87201	17.0612	36.0829	49
cluster_10.pdb ( medoid)	2.58835	10.8177	28.2446	28