CABS-dock: 537024aa517d062

Project name: 537024aa517d062

Status: done

submitted: 2026-06-12 13:21:39, status changed: 2026-06-12 15:24:36

Project settings

Protein sequence(s)	DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVSEY input pdb
Peptide sequence	AKMGEGGWGANDY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.3086	3.8214	15.6511	112
cluster_2.pdb ( medoid)	24.0584	5.40352	15.7837	130
cluster_3.pdb ( medoid)	21.4193	5.97591	23.1189	128
cluster_4.pdb ( medoid)	19.0028	6.8411	21.6361	130
cluster_5.pdb ( medoid)	18.8792	5.29684	31.9582	100
cluster_6.pdb ( medoid)	15.9519	10.8451	28.4446	173
cluster_7.pdb ( medoid)	15.6481	3.77043	14.6534	59
cluster_8.pdb ( medoid)	12.8161	8.81704	21.0547	113
cluster_9.pdb ( medoid)	2.75651	13.7855	30.0633	38
cluster_10.pdb ( medoid)	1.59698	10.6451	27.5749	17