Project name: published binder 25mer 2nd

Status: done

submitted: 2026-04-02 15:43:34, status changed: 2026-04-02 17:53:18

Project settings
Protein sequence(s) SMVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMMSQNFTNNCCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEEGSVANKFYYVHNDIFRYQDEVF input pdb
Peptide sequence LTFGDFDEHEVDALASGITFGDFDD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCHHHHHHHHHCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.5804 2.27563 14.1358 106
cluster_2.pdb ( medoid) 29.3397 4.90803 14.1523 144
cluster_3.pdb ( medoid) 28.2148 2.5873 13.5193 73
cluster_4.pdb ( medoid) 26.2202 6.02589 18.6394 158
cluster_5.pdb ( medoid) 22.9073 8.16334 22.7757 187
cluster_6.pdb ( medoid) 18.7569 6.39764 20.1111 120
cluster_7.pdb ( medoid) 12.1824 6.15641 16.0385 75
cluster_8.pdb ( medoid) 6.17603 11.4961 25.2289 71
cluster_9.pdb ( medoid) 4.70905 5.52128 8.59215 26
cluster_10.pdb ( medoid) 3.25542 12.2872 26.8262 40