Project name: 53a1e88de2518e3

Status: done

submitted: 2025-08-25 09:28:51, status changed: 2025-08-25 14:22:46

Project settings
Protein sequence(s) AHEYAQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAALNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPTGSTALKTVVDKAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLEFSTATFYLFGNSFYYGKGLINVQAAAQ input pdb
Peptide sequence ANSCNEPCVRQCQ
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.4758 4.81751 14.7298 142
cluster_2.pdb ( medoid) 25.8636 6.57295 29.2589 170
cluster_3.pdb ( medoid) 14.6257 9.02518 34.2721 132
cluster_4.pdb ( medoid) 11.7275 10.4882 37.1877 123
cluster_5.pdb ( medoid) 8.35413 11.3716 32.9814 95
cluster_6.pdb ( medoid) 8.11441 6.40835 28.0742 52
cluster_7.pdb ( medoid) 5.56211 10.6075 24.4209 59
cluster_8.pdb ( medoid) 5.33398 16.3105 42.603 87
cluster_9.pdb ( medoid) 5.23698 14.5122 32.589 76
cluster_10.pdb ( medoid) 4.33259 14.7718 31.1276 64