CABS-dock: 53dcf9ff93a3dc1

Project name: 53dcf9ff93a3dc1

Status: done

submitted: 2026-06-17 06:19:15, status changed: 2026-06-17 16:29:07

Project settings

Protein sequence(s)	ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGY input pdb
Peptide sequence	REQGATYQESN
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.5202	3.43077	32.0478	115
cluster_2.pdb ( medoid)	27.4034	8.06468	33.8161	221
cluster_3.pdb ( medoid)	20.5654	4.37628	16.6027	90
cluster_4.pdb ( medoid)	18.0197	4.16212	19.1222	75
cluster_5.pdb ( medoid)	17.7012	8.07853	27.5123	143
cluster_6.pdb ( medoid)	15.0309	6.5199	20.569	98
cluster_7.pdb ( medoid)	12.2967	7.15638	18.6912	88
cluster_8.pdb ( medoid)	7.74912	12.0014	24.4808	93
cluster_9.pdb ( medoid)	6.46319	7.42667	24.6612	48
cluster_10.pdb ( medoid)	1.77284	16.3579	32.747	29