Project name: 53dcf9ff93a3dc1

Status: done

submitted: 2026-06-17 06:19:15, status changed: 2026-06-17 16:29:07

Project settings
Protein sequence(s) ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGY input pdb
Peptide sequence REQGATYQESN
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.5202 3.43077 32.0478 115
cluster_2.pdb ( medoid) 27.4034 8.06468 33.8161 221
cluster_3.pdb ( medoid) 20.5654 4.37628 16.6027 90
cluster_4.pdb ( medoid) 18.0197 4.16212 19.1222 75
cluster_5.pdb ( medoid) 17.7012 8.07853 27.5123 143
cluster_6.pdb ( medoid) 15.0309 6.5199 20.569 98
cluster_7.pdb ( medoid) 12.2967 7.15638 18.6912 88
cluster_8.pdb ( medoid) 7.74912 12.0014 24.4808 93
cluster_9.pdb ( medoid) 6.46319 7.42667 24.6612 48
cluster_10.pdb ( medoid) 1.77284 16.3579 32.747 29