CABS-dock: 541c07d4865e52e

Project name: 541c07d4865e52e

Status: done

submitted: 2026-01-22 13:01:52, status changed: 2026-01-22 16:57:20

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	HANTAEIAESYDNRRL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.1842	3.46551	14.4267	115
cluster_2.pdb ( medoid)	29.1744	2.74213	17.4469	80
cluster_3.pdb ( medoid)	20.5239	8.08813	36.4928	166
cluster_4.pdb ( medoid)	9.34412	8.24047	29.4484	77
cluster_5.pdb ( medoid)	9.02288	10.1963	25.8625	92
cluster_6.pdb ( medoid)	8.84385	16.6217	31.8217	147
cluster_7.pdb ( medoid)	7.17597	8.22188	26.4966	59
cluster_8.pdb ( medoid)	6.44946	8.52784	19.2617	55
cluster_9.pdb ( medoid)	4.6676	13.4973	26.4402	63
cluster_10.pdb ( medoid)	2.7727	16.5903	36.9376	46